PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.7G014800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 889aa    MW: 96454.4 Da    PI: 5.1768
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.7G014800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57e-093779347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        +W++eE +++ + ++ +G++ +k+I++ +  ++t+ +c++++ k+
  Sevir.7G014800.1.p 37 AWSQEEKDIFSEKITTFGTD-FKKISSFLS-HKTPTDCIEYYSKH 79
                        7*******************.*********.***********986 PP

2Myb_DNA-binding27.38.3e-09232272446
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         WT  E   l++a++++G++ +++I+ ++g +++  qck+++ +
  Sevir.7G014800.1.p 232 WTNKERCHLIEAIEMHGMD-FSSISVHVG-TKSIQQCKNFLSN 272
                         9******************.*********.*********9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129313.8583384IPR017884SANT domain
SMARTSM007174.1E-93482IPR001005SANT/Myb domain
SuperFamilySSF466891.35E-103682IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-63781IPR009057Homeodomain-like
CDDcd001673.13E-63779No hitNo description
PfamPF139212.1E-63887No hitNo description
PROSITE profilePS5129311.178227278IPR017884SANT domain
SMARTSM007172.4E-4228276IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-6230269IPR009057Homeodomain-like
SuperFamilySSF466895.31E-8230277IPR009057Homeodomain-like
CDDcd001678.52E-6232269No hitNo description
PfamPF002491.1E-7232272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 889 aa     Download sequence    Send to blast
MPAIIIRKLQ KPREFLNKNI LFKEPQTNKL QGSGFKAWSQ EEKDIFSEKI TTFGTDFKKI  60
SSFLSHKTPT DCIEYYSKHY KSVCSKKSNK CVPTTKQSQE KCKNVNDAAP YMSGIATVTA  120
TKNYKKMKTV EEDLKKPANQ ICHESTAHLQ SHSLPDKGHH VESTIEEYEH VTGNVLVGEM  180
NAPSLHGMNS PTTNSSEAAR LTIPKTEVAE LKNLSEDSCS NGKTRKGEQE IWTNKERCHL  240
IEAIEMHGMD FSSISVHVGT KSIQQCKNFL SNCKNDLNLG KKHVNSNSNS TIGTNDRFVS  300
NVDSATCIIQ SYSKVKENVP QPVTSADHGD GENYQAGGSS GQGTSEIIKY LSESGQKIPN  360
VTTEDSQTIS GEENPELCAV SKECNDAAEH SWNDDTETNS NTHNDNNAPS DMENPTNDNN  420
PCISTNSAEL SGHHELVQPL EDSEALKIGS KENNDKAIRD EKNPEHSIAS KEGSGILLGC  480
IVNSQRDKEV VDIISSPEGS DLNVPPTLAS LGASNNSHLS STSSSAALQT VYAKSSRGEV  540
DMDLNLPLHV APPDLASVAL DSNRAEASMD LHEPRQTIDV AAIMEHELSI RARETIDVGG  600
DSEAANDVTH VQEIHQSSQT TVAETSHHPA NQPGCIMLFG QVIYQAPSSS GTNPTSSQGN  660
QIVASSRDIP SETVVPFRAG SGQLYPSGPS IIWRSAPVNL GQQTVLSNNT MNLDQQAVLS  720
NNTMNLGQQA VLSNTTMPYG STSGAAWRPL QLRNSALVNM SQQRQYVHMM MQYSMMRGAV  780
PYHLRQESSS SSGGGLINFN NFNPGQQQWP SNILDTSRVV MGYPCLPGST QDQAPTAIMP  840
SGINIEGAST SFQQQEEEED EGEGVVEGEE EGERAHNSGL AFGRSNKA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2099133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.17e-11MYB family protein